PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

MYB

Protein Properties

Length: 260aa MW: 30045.6 Da PI: 7.96

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.5G240000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.8	5.3e-18	4	49	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ Prupe.5G240000.1.p 4 RGHWRPAEDEKLRELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49 899***************************.*********996 PP
2	Myb_DNA-binding	54.7	2.3e-17	56	99	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ Prupe.5G240000.1.p 56 RNPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99 789*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.07	1	54	IPR017930	Myb domain
SMART	SM00717	2.9E-15	3	52	IPR001005	SANT/Myb domain
Pfam	PF00249	9.5E-18	4	49	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.42E-29	4	97	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.7E-27	5	57	IPR009057	Homeodomain-like
CDD	cd00167	9.50E-14	7	48	No hit	No description
PROSITE profile	PS51294	20.6	55	105	IPR017930	Myb domain
SMART	SM00717	2.2E-15	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	3.0E-14	56	98	IPR001005	SANT/Myb domain
CDD	cd00167	2.61E-11	58	98	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.3E-20	58	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 260 aa Download sequence Send to blast
MCTRGHWRPA EDEKLRELVE RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRNPFT 60 EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARRCRERSR LHAKLIRTSS 120 TTSTAVPQSS LTASNINIDI PKSFSKQDHL QINCDITRNL DAYNYFGKFY PPFTHNPPPP 180 PFPREFYYPN TCVTMHQDHK DQPIEFYDFL QVNTESNGSE VIDNARKDEE EVDQEAVGQQ 240 ISKAAGAPFI EFLSVNGSS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-32	2	105	5	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21399993}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00145	DAP	Transfer from AT1G17950	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.5G240000.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP711287	1e-113	KP711287.1 Betula platyphylla MYB transcription factor 3 (MYB3) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020419093.1	0.0	transcription factor MYB52
Swissprot	Q6R0C4	3e-89	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A251PD06	0.0	A0A251PD06_PRUPE; Uncharacterized protein
STRING	XP_008240389.1	0.0	(Prunus mume)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	3e-92	myb domain protein 52

Link Out ? help Back to Top
Phytozome	Prupe.5G240000.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]