PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.5G148700.1.p | ||||||||
Common Name | PRUPE_ppa012414mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 171aa MW: 19564.1 Da PI: 9.8511 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.2 | 3.4e-33 | 91 | 149 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s+fprsYYrCt++gC vkk+v+r ++d+++v++tYeg H h+ Prupe.5G148700.1.p 91 LDDGYRWRKYGQKTVKNSKFPRSYYRCTHQGCIVKKQVQRLSKDEEIVVTTYEGIHSHP 149 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.5E-33 | 76 | 149 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.49E-30 | 83 | 150 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.849 | 86 | 151 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.2E-38 | 91 | 150 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.7E-27 | 92 | 149 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MEHNQILFLA LPKSSESASP NLSSNPSNIS QVFPRFHFDS AGLMKKEAKI YQHCGTSYGS 60 VDKMKPGKKE GGKETKKHKY AFQTRSQVDI LDDGYRWRKY GQKTVKNSKF PRSYYRCTHQ 120 GCIVKKQVQR LSKDEEIVVT TYEGIHSHPT DETSAENFDQ ILRHLQTYNA * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-27 | 81 | 148 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-27 | 81 | 148 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ppe.1891 | 0.0 | fruit |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.5G148700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007209695.1 | 1e-127 | probable WRKY transcription factor 43 | ||||
Swissprot | Q9FYA2 | 3e-46 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | M5WAY9 | 1e-125 | M5WAY9_PRUPE; Uncharacterized protein | ||||
STRING | EMJ10894 | 1e-126 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 1e-47 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.5G148700.1.p |
Entrez Gene | 18777012 |