![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.1G407500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 188aa MW: 21331.7 Da PI: 5.4066 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.5 | 2e-31 | 127 | 184 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDg++WrKYG+K+vk+s++pr+YY+C+ +gCpvkk+ver+++dp +v++tYeg Hnh Prupe.1G407500.1.p 127 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVEGCPVKKRVERDRDDPGFVITTYEGVHNH 184 59******************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.0E-33 | 113 | 184 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.45E-28 | 120 | 184 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.769 | 122 | 184 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.3E-37 | 127 | 186 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.6E-25 | 128 | 184 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MISTCSLVTK LCVKKAFTTF LVAKLMSNSN NFRAQESPEN DFSEQSNFEF SEYLMIGEWL 60 DEDHPTSMAL ETVQNSGYQA NEVDESRGSS SQLGGSNSRE NESGSVQERQ EVRERVAFKT 120 KSEVEILDDG FKWRKYGKKM VKNSPNPRNY YKCSVEGCPV KKRVERDRDD PGFVITTYEG 180 VHNHLSL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 117 | 184 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 117 | 184 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.1G407500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 4e-35 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 4e-35 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020409575.1 | 1e-139 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 2e-49 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A251RAL2 | 1e-138 | A0A251RAL2_PRUPE; Uncharacterized protein | ||||
STRING | XP_008220527.1 | 1e-110 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 5e-51 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.1G407500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|