![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c7_11120V3.1.p | ||||||||
Common Name | PHYPADRAFT_80556 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 148aa MW: 16807.3 Da PI: 10.4429 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41 | 4.3e-13 | 75 | 116 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT eE +++++a k +G++ +++Ia+ +g +R+ q++ + qky Pp3c7_11120V3.1.p 75 WTNEERQRFKKALKTFGTD-FAAIAKFVG-TRSSTQVRTHAQKY 116 *******************.*********.*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.569 | 63 | 121 | IPR017930 | Myb domain |
SMART | SM00717 | 2.8E-11 | 71 | 119 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.77E-12 | 72 | 120 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.3E-8 | 73 | 119 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.5E-7 | 74 | 112 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.7E-12 | 74 | 116 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-9 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0030018 | anatomy | gametophore |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MDQCGVMLAP ASSRKVKSMI PEHCLQNMDS LGLQQLEHLE KELEQAKKKI LVLKAQEHRE 60 TSSPDTKQVS ESRYWTNEER QRFKKALKTF GTDFAAIAKF VGTRSSTQVR THAQKYYAKL 120 IRDYKRSGKA GTTMKAREDA TTRLPAM* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024380186.1 | 1e-107 | myb-like protein I | ||||
TrEMBL | A0A2K1KBB1 | 1e-105 | A0A2K1KBB1_PHYPA; Uncharacterized protein | ||||
STRING | PP1S87_134V6.1 | 1e-106 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP11644 | 4 | 7 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G37260.1 | 6e-11 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c7_11120V3.1.p |
Entrez Gene | 5930009 |
Publications ? help Back to Top | |||
---|---|---|---|
|