PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c27_7510V3.2.p | ||||||||
Common Name | PHYPADRAFT_140223 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 161aa MW: 18119.7 Da PI: 10.3831 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169.4 | 1.1e-52 | 15 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeelv +yL +k+e+ ++++ vi+e+d+yk++PwdLp k+ +e ewyfFs+rd+ky++g r+nra++sg+Wkatg+d++v Pp3c27_7510V3.2.p 15 LPPGFRFHPTDEELVLHYLWRKTESATFSI-PVITELDLYKYDPWDLPGKAILGEGEWYFFSPRDRKYPNGARPNRAAASGFWKATGTDRPV 105 79***************************9.89***************76667889************************************ PP NAM 93 lsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ + +++g+kk Lvfykgrapkg+kt+Wvmheyrl Pp3c27_7510V3.2.p 106 HTSrgTLQKIGVKKALVFYKGRAPKGVKTTWVMHEYRL 143 *99555567***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.2E-58 | 9 | 148 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.723 | 15 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-27 | 16 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MASSSGVPVI PQIELPPGFR FHPTDEELVL HYLWRKTESA TFSIPVITEL DLYKYDPWDL 60 PGKAILGEGE WYFFSPRDRK YPNGARPNRA AASGFWKATG TDRPVHTSRG TLQKIGVKKA 120 LVFYKGRAPK GVKTTWVMHE YRLADGISPS SNTTRKPGSL R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swm_B | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swm_C | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swm_D | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swp_A | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swp_B | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swp_C | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
3swp_D | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
4dul_A | 3e-64 | 10 | 161 | 12 | 153 | NAC domain-containing protein 19 |
4dul_B | 3e-64 | 10 | 161 | 12 | 153 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}. | |||||
Uniprot | TISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024367540.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367541.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367542.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367544.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367545.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367546.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367547.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367548.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367549.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367550.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367551.1 | 1e-115 | NAC transcription factor 25-like | ||||
Refseq | XP_024367552.1 | 1e-115 | NAC transcription factor 25-like | ||||
Swissprot | Q8H4S4 | 2e-70 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
TrEMBL | A0A2K1IB21 | 1e-114 | A0A2K1IB21_PHYPA; Uncharacterized protein | ||||
TrEMBL | A9T4L6 | 1e-114 | A9T4L6_PHYPA; Predicted protein | ||||
STRING | PP1S164_33V6.1 | 1e-114 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.2 | 5e-71 | NAC domain containing protein 47 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c27_7510V3.2.p |
Entrez Gene | 5936776 |
Publications ? help Back to Top | |||
---|---|---|---|
|