PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c14_24330V3.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 84aa MW: 9381.08 Da PI: 11.6986 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 46.7 | 9.1e-15 | 19 | 53 | 1 | 35 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhk 35 aCaaC+vlrrkC+++C +ap fp +qp+kfa vhk Pp3c14_24330V3.1.p 19 ACAACRVLRRKCTAQCLFAPFFPPDQPQKFAHVHK 53 7*********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51257 | 6 | 1 | 20 | No hit | No description |
PROSITE profile | PS50891 | 11.468 | 18 | 83 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.8E-13 | 19 | 53 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MHSYRRLRMV MVSALGTSAC AACRVLRRKC TAQCLFAPFF PPDQPQKFAH VHKDGRLGIT 60 RLGLLLISQH NPRIIPTRHD ANS* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves, flowers and adaxial domains of cotyledonary and leaves primordia. {ECO:0000269|PubMed:12040093, ECO:0000269|PubMed:12068116, ECO:0000269|PubMed:17559509}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. | |||||
UniProt | Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11311158, PubMed:12787254, PubMed:12874130, PubMed:14508003, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509). Required for the binding of AS1 to the KNOX genes (PubMed:23271976). Involved in leaf polarity establishment by functioning cooperatively with RH10 or RID2 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:12874130, ECO:0000269|PubMed:14508003, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024358386.1 | 4e-28 | LOB domain-containing protein 6-like | ||||
Swissprot | O04479 | 2e-15 | AS2_ARATH; Protein ASYMMETRIC LEAVES 2 | ||||
Swissprot | Q9FKZ3 | 5e-15 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A2K1JJ48 | 2e-54 | A0A2K1JJ48_PHYPA; Uncharacterized protein | ||||
STRING | PP1S69_130V6.1 | 7e-31 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 6e-17 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c14_24330V3.1.p |