PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 189aa MW: 21687.7 Da PI: 10.1177

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.019G018200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.6	6e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv +++ +G g+W++ ++ g+ R++k+c++rw +yl Potri.019G018200.1 14 KGPWTPEEDQILVSYIRSYGHGNWRALPKQAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	55	1.9e-17	67	113	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE+e ++++++ lG++ W++Ia++++ gRt++++k++w+++l Potri.019G018200.1 67 RGNFSNEEEETIIKLHQILGNR-WSAIAARLPAGRTDNEIKNYWHSHL 113 89******************.********************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.2E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.582	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	4.21E-29	10	109	IPR009057	Homeodomain-like
SMART	SM00717	2.3E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	7.65E-12	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.6E-26	65	116	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-16	66	115	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.413	66	117	IPR017930	Myb domain
Pfam	PF00249	5.0E-16	67	113	IPR001005	SANT/Myb domain
CDD	cd00167	5.42E-11	69	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 189 aa Download sequence Send to blast
MGRAPCCEMM GLKKGPWTPE EDQILVSYIR SYGHGNWRAL PKQAGLLRCG KSCRLRWINY 60 LRPDIKRGNF SNEEEETIIK LHQILGNRWS AIAARLPAGR TDNEIKNYWH SHLKKRFQQN 120 MGRPTEHCRK TPERAMVNNT SSSQPASFKV HQSKCQRQSP SDNAPIFQEA SSQEMFSSMA 180 TMEAMNGFS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-28	12	118	5	109	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Fades out in old roots and leaves. {ECO:0000269\|PubMed:24415840}.
Uniprot	TISSUE SPECIFICITY: Expressed in imbibed seeds, hypocotyls, cotyledons, roots, seedlings, siliques and flowers. {ECO:0000269\|PubMed:24415840}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269\|PubMed:24415840}.
UniProt	Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|PubMed:22246661}.
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.019G018200.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold stress. {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|Ref.2}.
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.
UniProt	INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:24415840}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024447113.1	1e-141	transcription factor MYB4
Swissprot	Q7XBH4	5e-73	MYB4_ORYSJ; Transcription factor MYB4
Swissprot	Q9LTC4	6e-73	MYB15_ARATH; Transcription factor MYB15
Swissprot	Q9SJX8	4e-73	MYB14_ARATH; Transcription factor MYB14
TrEMBL	A0A3N7G7Y5	1e-140	A0A3N7G7Y5_POPTR; Uncharacterized protein
STRING	POPTR_0019s03490.1	1e-135	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31180.1	2e-75	myb domain protein 14

Link Out ? help Back to Top
Phytozome	Potri.019G018200.1
Entrez Gene	7465941

Publications ? help Back to Top
Park MR, et al. Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development. Plant Cell Environ., 2010. 33(12): p. 2209-30 [PMID:20807373] Soltész A, et al. The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants. J. Appl. Genet., 2012. 53(2): p. 133-43 [PMID:22246661] Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen Y, et al. AtMYB14 Regulates Cold Tolerance in Arabidopsis. Plant Mol. Biol. Rep., 2013. 31: p. 87-97 [PMID:24415840] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]