![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.018G048000.1 | ||||||||
Common Name | POPTR_0018s08400g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 83aa MW: 9487.28 Da PI: 10.5272 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 56.1 | 4.9e-18 | 16 | 53 | 8 | 45 |
HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 rq +skR+ gilKKA+EL +LCd++ a+++fs+tgk Potri.018G048000.1 16 ARQAKYSKRKIGILKKAKELAILCDIDLALLMFSPTGK 53 69999********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.9E-22 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 21.866 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.7E-21 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-15 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-17 | 14 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-15 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-15 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MGRRRLKIQR LECVKARQAK YSKRKIGILK KAKELAILCD IDLALLMFSP TGKPTLYVGQ 60 DKDFGTVLDR MSALTFEERE ER* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.018G048000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007012432.1 | 4e-40 | PREDICTED: agamous-like MADS-box protein AGL65 | ||||
Swissprot | Q7X9I0 | 2e-23 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
TrEMBL | B9IKF0 | 1e-51 | B9IKF0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0018s08400.1 | 2e-52 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF20519 | 5 | 5 |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26320.1 | 2e-19 | AGAMOUS-like 33 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.018G048000.1 |
Entrez Gene | 7476682 |
Publications ? help Back to Top | |||
---|---|---|---|
|