PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 242aa MW: 28265.7 Da PI: 8.3398

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.017G017600.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.3	1.5e-17	4	49	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v q+G+++W++Ia++++ g+++k+c++rw++ Potri.017G017600.1 4 RGHWRPAEDEKLRKLVDQYGPHNWNSIAEKLQ-GKSGKSCRLRWFNQ 49 899***************************.*********996 PP
2	Myb_DNA-binding	54.1	3.6e-17	56	98	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r ++T+eE+e+l+ + + +G++ W+ Ia+ ++ gRt++ +k++w+ Potri.017G017600.1 56 RSPFTEEEEERLLACQQIHGNK-WAVIAKQFP-GRTDNAVKNHWH 98 789*****************.*****.*********6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.963	1	50	IPR017930	Myb domain
SMART	SM00717	2.9E-14	3	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	7.49E-29	4	97	IPR009057	Homeodomain-like
Pfam	PF00249	9.6E-17	4	49	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-26	5	57	IPR009057	Homeodomain-like
CDD	cd00167	1.06E-12	7	48	No hit	No description
PROSITE profile	PS51294	25.489	51	105	IPR017930	Myb domain
SMART	SM00717	1.4E-14	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-14	56	98	IPR001005	SANT/Myb domain
CDD	cd00167	6.97E-11	58	98	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.7E-21	58	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 242 aa Download sequence Send to blast
MSTRGHWRPA EDEKLRKLVD QYGPHNWNSI AEKLQGKSGK SCRLRWFNQL DPRINRSPFT 60 EEEEERLLAC QQIHGNKWAV IAKQFPGRTD NAVKNHWHII MARKCRERSR IHAKRAASQA 120 LLVNEQTHSF SNQDVMRIVN CEPRNLAPSF FHKFCESYCD CYHRPFCLNY PTSFCNENTS 180 HHEGKPLEFY DFLQVKTDSS KSEALDNARR DDVEVDQEAR ELHQRKANFP FIDFLSAGNS 240 N*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	3e-30	1	105	1	105	C-Myb DNA-Binding Domain
1msf_C	3e-30	1	105	1	105	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21399993}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.017G017600.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB970791	0.0	AB970791.1 Populus tremula x Populus tremuloides PtxtMYB175 mRNA for MYB transcriptional factor, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006372770.1	0.0	transcription factor MYB54
Swissprot	Q6R0C4	4e-80	MYB52_ARATH; Transcription factor MYB52
TrEMBL	B9MYB8	0.0	B9MYB8_POPTR; Uncharacterized protein
STRING	POPTR_0012s03650.1	1e-103	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	2e-82	myb domain protein 52

Link Out ? help Back to Top
Phytozome	Potri.017G017600.1
Entrez Gene	18106820

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]