PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 186aa MW: 21182.8 Da PI: 9.8953

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.015G041100.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.8	2.5e-18	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++++G g+W++ ++ g+ R++k+c++rw++yl Potri.015G041100.1 13 KGAWSQQEDQKLIDYIQKHGEGCWRSLPQAAGLLRCGKSCRLRWRNYL 60 79****************************99***********7 PP
2	Myb_DNA-binding	48.9	1.5e-15	68	110	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++ Potri.015G041100.1 68 GFGEDEEDLIIRLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110 5789**************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.6E-23	4	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.688	8	60	IPR017930	Myb domain
SMART	SM00717	4.1E-14	12	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.5E-28	12	107	IPR009057	Homeodomain-like
Pfam	PF00249	6.6E-17	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	7.10E-11	15	60	No hit	No description
PROSITE profile	PS51294	23.228	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.4E-23	63	115	IPR009057	Homeodomain-like
SMART	SM00717	3.4E-14	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-14	69	110	IPR001005	SANT/Myb domain
CDD	cd00167	2.33E-10	71	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MRKPCCDKQY TNKGAWSQQE DQKLIDYIQK HGEGCWRSLP QAAGLLRCGK SCRLRWRNYL 60 RPDLKRDGFG EDEEDLIIRL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRKKLESSHR 120 NTGFTRLRAE ISSAARSKRQ ANVPETQVFD SNGGKPEPSN KSSSDINLDL TLSIPSKKLE 180 SSDEN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	5e-29	12	115	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. {ECO:0000269\|PubMed:9839469}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.015G041100.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002322088.1	1e-135	transcription factor MYB3
Refseq	XP_024442261.1	1e-135	transcription factor MYB3
Swissprot	Q9S9K9	2e-68	MYB3_ARATH; Transcription factor MYB3
TrEMBL	B9IEA0	1e-134	B9IEA0_POPTR; Uncharacterized protein
STRING	POPTR_0015s04300.1	1e-135	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF264	34	221
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	8e-71	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Potri.015G041100.1
Entrez Gene	7462479

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]