PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 237aa MW: 28135.6 Da PI: 8.7098

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.015G033600.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.4	7.1e-18	4	49	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l+++v+++G+++W++Ia+++ gR++k+c++rw++ Potri.015G033600.1 4 RGHWRPAEDEKLKELVEKYGPHNWNAIAEKLH-GRSGKSCRLRWFNQ 49 899***************************.*********996 PP
2	Myb_DNA-binding	55.6	1.2e-17	56	99	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ Potri.015G033600.1 56 RSPFTEEEEERLLASHRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 99 789*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.613	1	54	IPR017930	Myb domain
SMART	SM00717	2.1E-15	3	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.12E-30	4	97	IPR009057	Homeodomain-like
Pfam	PF00249	1.9E-17	4	49	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.6E-28	5	57	IPR009057	Homeodomain-like
CDD	cd00167	6.83E-13	7	48	No hit	No description
PROSITE profile	PS51294	20.051	55	105	IPR017930	Myb domain
SMART	SM00717	2.1E-15	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-14	56	98	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.0E-21	58	104	IPR009057	Homeodomain-like
CDD	cd00167	1.16E-10	58	98	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 237 aa Download sequence Send to blast
MCTRGHWRPA EDEKLKELVE KYGPHNWNAI AEKLHGRSGK SCRLRWFNQL DPRINRSPFT 60 EEEEERLLAS HRIHGNRWAV IARLFPGRTD NAVKNHWHVI MARRYRERSR LHAKRTAQAL 120 VNEQKFSSKQ DMQINCETRS FSSFVKKYCE KFGQYPLITH SYLPAFWKEF YNDDLSNCKD 180 QNRPIEFYDF LQVNTESNKS EVIDNARRED EEVDQREVIL EHQSKAGVPF IDFFSA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-33	2	104	5	107	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21399993}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Function -- GeneRIF ? help Back to Top
A role of R2R3 protein in salt stress tolerance and the regulation of lateral root emergence [PMID: 28285084]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.015G033600.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ807471	0.0	FJ807471.1 Populus trichocarpa MYB transcription factor (MYB090) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006374219.1	1e-179	transcription factor MYB54
Swissprot	Q6R0C4	2e-84	MYB52_ARATH; Transcription factor MYB52
TrEMBL	U5FPX4	1e-177	U5FPX4_POPTR; Uncharacterized protein
STRING	POPTR_0015s05130.1	1e-178	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	3e-82	myb domain protein 52

Link Out ? help Back to Top
Phytozome	Potri.015G033600.1
Entrez Gene	18105577

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Fang Q, et al. A salt-stress-regulator from the Poplar R2R3 MYB family integrates the regulation of lateral root emergence and ABA signaling to mediate salt stress tolerance in Arabidopsis. Plant Physiol. Biochem., 2017. 114: p. 100-110 [PMID:28285084] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]