![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.014G167100.1 | ||||||||
Common Name | POPTR_0014s16510g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 173aa MW: 19744.5 Da PI: 6.3495 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 122 | 3.1e-38 | 14 | 113 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 +CaaC++lrr+C ++C+lapyfp ++++kf vhk+FGasnv+++++ ++e+++eda+++++yeA r+rdPvyG++g+i++lq+ +e+lk Potri.014G167100.1 14 PCAACRMLRRRCDSNCMLAPYFPGDEAEKFFGVHKVFGASNVIRMIQMVDESKKEDAVKAIIYEATSRLRDPVYGSAGTIFHLQRMVEELK 104 7****************************************************************************************** PP DUF260 92 aelallkee 100 ++++++++ Potri.014G167100.1 105 MQVESMRAQ 113 ***998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.240.10 | 3.2E-4 | 5 | 28 | IPR001138 | Zn(2)-C6 fungal-type DNA-binding domain |
PROSITE profile | PS50891 | 24.472 | 13 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.1E-38 | 14 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MSSQAQTRTR AHQPCAACRM LRRRCDSNCM LAPYFPGDEA EKFFGVHKVF GASNVIRMIQ 60 MVDESKKEDA VKAIIYEATS RLRDPVYGSA GTIFHLQRMV EELKMQVESM RAQVVQLQEQ 120 RNQLLGILMN VRHLDSTSSV HDSKFDGGNF MLDEDSMAYD PMTFFTENDW TF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-33 | 5 | 116 | 2 | 113 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-33 | 5 | 116 | 2 | 113 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.014G167100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002321198.1 | 1e-129 | LOB domain-containing protein 1 | ||||
Swissprot | Q9LQR0 | 1e-42 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
Swissprot | Q9SK08 | 2e-42 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | B9IAT5 | 1e-127 | B9IAT5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0014s16510.1 | 1e-128 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14068 | 19 | 21 | Representative plant | OGRP13259 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 6e-45 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.014G167100.1 |
Entrez Gene | 7456008 |