PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 271aa MW: 30743 Da PI: 10.1679

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.014G100800.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.7	4e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl Potri.014G100800.1 14 RGPWTPREDTLLTKYIQAHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61 89****************************99**********97 PP
2	Myb_DNA-binding	52.3	1.3e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T++Ed+l+++ + +lG++ W++Ia +++ gRt++++k++w+++l Potri.014G100800.1 67 RGNITPDEDDLIIRMHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112 7999****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.392	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	5.62E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.0E-14	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.6E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	5.73E-10	16	61	No hit	No description
PROSITE profile	PS51294	25.663	62	116	IPR017930	Myb domain
SMART	SM00717	1.3E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	5.1E-15	67	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-25	69	116	IPR009057	Homeodomain-like
CDD	cd00167	2.66E-12	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 271 aa Download sequence Send to blast
MGRAPCCSKV GLHRGPWTPR EDTLLTKYIQ AHGEGHWRSL PKKAGLLRCG KSCRLRWMNY 60 LRPDIKRGNI TPDEDDLIIR MHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLVKRLRSQG 120 ITDPGTHRKL AEPGEREVKR RRSNKNTSNK KQNKSKAKLI LPAEKHKVHL PKPVRFTSLP 180 LPRNDSFESN TITISPSQGR DQGSFGTGDS FLVGDNDRYG LVNGSDLECQ SPVPTTNTLE 240 KLYEEYLQLL EIDDRQDQVL LDSFADSLLV *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	5e-25	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Expressed in anthers (PubMed:24319076, PubMed:25053018). Expressed in pollen grains and mature seeds (PubMed:25053018). Expressed in roots and vasculature of leaves (PubMed:24319076). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269\|PubMed:1840903}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.014G100800.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002320876.1	0.0	myb-related protein 308
Swissprot	P81393	2e-66	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q42379	4e-66	MYB7_ARATH; Transcription factor MYB7
TrEMBL	B9I900	0.0	B9I900_POPTR; Uncharacterized protein
STRING	POPTR_0014s09630.1	0.0	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16720.1	9e-68	myb domain protein 7

Link Out ? help Back to Top
Phytozome	Potri.014G100800.1
Entrez Gene	7486782

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]