PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 244aa MW: 27515.8 Da PI: 7.3841

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.009G027300.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.1	1.8e-17	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed ll++ v+++G ++W+ Ia+ g++Rt+k+c++rw +yl Potri.009G027300.1 10 KGPWTEQEDILLINFVNLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 57 79********************************************97 PP
2	Myb_DNA-binding	53.5	5.3e-17	63	107	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w+++ Potri.009G027300.1 63 RGKMTPQEERLVLELHARWGNR-WSRIARKLP-GRTDNEIKNYWRTH 107 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.586	5	57	IPR017930	Myb domain
SuperFamily	SSF46689	8.8E-30	9	104	IPR009057	Homeodomain-like
SMART	SM00717	3.8E-16	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-16	10	57	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-21	11	64	IPR009057	Homeodomain-like
CDD	cd00167	4.54E-12	12	57	No hit	No description
PROSITE profile	PS51294	25.532	58	112	IPR017930	Myb domain
SMART	SM00717	6.8E-16	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-15	63	107	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-23	65	111	IPR009057	Homeodomain-like
CDD	cd00167	6.14E-12	65	107	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009751	Biological Process	response to salicylic acid
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 244 aa Download sequence Send to blast
MKMMQDETRK GPWTEQEDIL LINFVNLFGD RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG 60 LKRGKMTPQE ERLVLELHAR WGNRWSRIAR KLPGRTDNEI KNYWRTHTRK KAQERKSVVS 120 PSLSSSNCSS SSNITTVNSS SPPGTGEASF YDTGGLEQVA SAGKNGEAVQ GGEKGYSMDD 180 IWRDIENTIE PVCDGFSEEG CNFSYPSLAS PSWEYRPDIL WSISGEESKM FLPYDDGTML 240 LTG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	5e-28	2	112	50	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	5e-28	2	112	50	159	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pth.2779	0.0	stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.009G027300.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (SA). {ECO:0000269\|PubMed:16463103}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002313452.2	0.0	transcription factor MYB48 isoform X2
Swissprot	Q9LX82	4e-99	MYB48_ARATH; Transcription factor MYB48
TrEMBL	B9HPK9	0.0	B9HPK9_POPTR; Uncharacterized protein
STRING	POPTR_0009s03240.1	0.0	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4378	33	59
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G46130.1	9e-97	myb domain protein 48

Link Out ? help Back to Top
Phytozome	Potri.009G027300.1
Entrez Gene	7488139

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Imran QM, et al. Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes. Sci Rep, 2018. 8(1): p. 771 [PMID:29335449]