![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.009G022000.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 146aa MW: 16479.8 Da PI: 5.3022 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 39.8 | 1e-12 | 1 | 69 | 30 | 98 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 +++dedv +i+ +P l+ska elf+ +l r++ + + +tl+ ++++v+ ++fdfl +iv + Potri.009G022000.1 1 MQTDEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLKRGAKTLNSLHLKQCVQTFNVFDFLREIVSK 69 889**************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 5.3E-13 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.38E-19 | 1 | 71 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 3.6E-18 | 1 | 68 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MQTDEDVGKI AMAVPLLVSK ALELFLQDLC DRTYEITLKR GAKTLNSLHL KQCVQTFNVF 60 DFLREIVSKV PDLGGPDAAF DEHGIGKRRK VADDEDNDSD EECNRSRTET RVDVFIFIMH 120 GQQTNVFESF KSGSRRKDTL KLLVL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 2e-16 | 1 | 55 | 21 | 75 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.009G022000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024464939.1 | 5e-73 | LOW QUALITY PROTEIN: dr1-associated corepressor homolog | ||||
Swissprot | A0JPP1 | 1e-22 | NC2A_RAT; Dr1-associated corepressor | ||||
Swissprot | Q14919 | 1e-22 | NC2A_HUMAN; Dr1-associated corepressor | ||||
Swissprot | Q2YDP3 | 1e-22 | NC2A_BOVIN; Dr1-associated corepressor | ||||
TrEMBL | A0A3N7FHW1 | 6e-73 | A0A3N7FHW1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0009s02710.1 | 3e-59 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1728 | 34 | 91 |
Representative plant | OGRP2179 | 16 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 9e-44 | nuclear factor Y, subunit C11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.009G022000.1 |