![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.008G044800.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 177aa MW: 19113.4 Da PI: 6.531 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 179.3 | 3.4e-56 | 25 | 117 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+eplkvyl++yr Potri.008G044800.1 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYR 115 69***************************************************************************************** PP NF-YB 92 el 93 e Potri.008G044800.1 116 EQ 117 95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-53 | 20 | 133 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.97E-40 | 28 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.2E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 2.2E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MADNPTSPAA GSHESGGEQS PRSGVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ 60 ECVSEFISFV TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKVY LARYREQLWQ 120 GDAKGSARGG DGSSKRDAVG GLPGQNAQFA FQGSMNYTSP QVQGQHMILP SMPGNE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 8e-48 | 24 | 116 | 1 | 93 | NF-YB |
4awl_B | 7e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 7e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.1727 | 0.0 | bud| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.008G044800.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011036599.1 | 1e-124 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_011037351.1 | 1e-124 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_011038112.1 | 1e-124 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_024461881.1 | 1e-124 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461882.1 | 1e-124 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461883.1 | 1e-124 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Swissprot | Q8VYK4 | 6e-80 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2K1ZBP5 | 1e-123 | A0A2K1ZBP5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0010s22360.1 | 1e-114 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 3e-82 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.008G044800.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|