PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9096.71 Da PI: 10.6319

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.002G109700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	88.8	2.8e-28	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly++ss Potri.002G109700.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTGKLYDFSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.8E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.328	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.95E-37	2	60	No hit	No description
SuperFamily	SSF55455	2.35E-28	2	63	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.5E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TGKLYDFSST 60 RSDFKISLIY IYIYLLTLQG *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-18	1	70	1	69	MEF2C
5f28_B	1e-18	1	70	1	69	MEF2C
5f28_C	1e-18	1	70	1	69	MEF2C
5f28_D	1e-18	1	70	1	69	MEF2C
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:14701936}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.002G109700.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026433220.1	4e-36	MADS-box transcription factor 23-like isoform X3
Swissprot	Q6EP49	3e-33	MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBL	A0A438G0F5	1e-36	A0A438G0F5_VITVI; MADS-box transcription factor ANR1
STRING	POPTR_0001s29100.1	3e-37	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.1	2e-35	AGAMOUS-like 16

Link Out ? help Back to Top
Phytozome	Potri.002G109700.1

Publications ? help Back to Top
Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876]