PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.001G367500.1 | ||||||||
Common Name | POPTR_0001s37620g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 168aa MW: 18193.2 Da PI: 4.756 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.3 | 8.4e-57 | 23 | 118 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 re drflP+anvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re Potri.001G367500.1 23 REMDRFLPVANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFRE 113 799**************************************************************************************** PP NF-YB 93 legek 97 +egek Potri.001G367500.1 114 MEGEK 118 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.5E-53 | 19 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.59E-41 | 26 | 152 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-27 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.6E-21 | 56 | 74 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.6E-21 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 5.6E-21 | 94 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MADSDNDSGG QNPTSTNELF SPREMDRFLP VANVSRIMKK ALPANAKISK EAKETVQECV 60 SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFEEY VEPLKVYLQR FREMEGEKNT 120 VARDRDAPSN GSGPGAEGFS GYVYGSGAGF FNQMGGGGAG DSLGRLR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-46 | 23 | 113 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-46 | 23 | 113 | 2 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 4e-46 | 20 | 113 | 4 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.001G367500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC214028 | 0.0 | AC214028.1 Populus trichocarpa clone POP025-N21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002298867.2 | 1e-121 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 4e-69 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q75IZ7 | 1e-68 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2K2C9J8 | 1e-120 | A0A2K2C9J8_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0001s37620.1 | 1e-120 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-71 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.001G367500.1 |
Entrez Gene | 7487543 |
Publications ? help Back to Top | |||
---|---|---|---|
|