 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Potri.001G169600.1 |
| Common Name | POPTR_0001s16970g |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
| Family |
MYB |
| Protein Properties |
Length: 195aa MW: 22536.6 Da PI: 9.1874 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Potri.001G169600.1 | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 58.2 | 1.9e-18 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +l+++++ +G ++W+tIa++ ++R++k+c++rw++yl
Potri.001G169600.1 18 KGAWTAEEDRKLAEVIATHGAKRWRTIASKAALNRCGKSCRLRWLNYL 65
79********************************************97 PP
|
| 2 | Myb_DNA-binding | 50.8 | 3.7e-16 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
Potri.001G169600.1 71 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116
78999*****************.*********.************986 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 195 aa
Download sequence Send
to blast |
MATMKKESVK TMETMPNKGA WTAEEDRKLA EVIATHGAKR WRTIASKAAL NRCGKSCRLR 60
WLNYLRPNIK RGNISDQEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKI 120
NKKGKQIEAS NRECQKIEKK TVEISLELKE DNKPHNGSEE GSNVNFNIDD LFDFTDEDTL 180
NMEWMSRFLE MDEA*
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: First expressed in leaf primordia. Later confined to developing trichome cells where it persists at high levels throughout all stages of trichome development. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15728674}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, seed coats, leaves, stems and flowers. Detected specifically in trichomes, and in the cell division and differentiation zone of the root. {ECO:0000269|PubMed:11437443}. |
| Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
| Publications
? help Back to Top |
- Savage N, et al.
Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
PLoS ONE, 2013. 8(10): p. e75452
[PMID:24130712] - Cheng Y, et al.
Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
Elife, 2018.
[PMID:24771765] - Khosla A, et al.
HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
Plant Cell, 2014. 26(5): p. 2184-2200
[PMID:24824485] - Yu D, et al.
RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis.
Plant Physiol. Biochem., 2015. 88: p. 82-8
[PMID:25676129] - Kiefer CS, et al.
Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
Development, 2015. 142(5): p. 1022
[PMID:25715402] - Kwak SH,Song SK,Lee MM,Schiefelbein J
TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
Plant Signal Behav, 2015. 10(12): p. e1103407
[PMID:26451798] - Zhu Y, et al.
The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
Plant Cell, 2017. 29(2): p. 260-276
[PMID:28138017] - Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
Plant J., 2017. 92(2): p. 305-316
[PMID:28771873] - Mira MM, et al.
Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
J. Exp. Bot., 2017. 68(20): p. 5653-5668
[PMID:29059380] - Lung SC, et al.
Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
New Phytol., 2018. 218(1): p. 183-200
[PMID:29288621] - Kohanová J, et al.
Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
Ann. Bot., 2018. 122(5): p. 903-914
[PMID:29394308]
|
