![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.011G095500.1 | ||||||||
Common Name | PHAVU_011G095500g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 230aa MW: 26218.4 Da PI: 6.6784 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 136.9 | 1.3e-42 | 9 | 140 | 2 | 127 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 ppGfrF Pt+eelv +yL++k+eg + +++vi+ vdi+ +ePw+Lp+ +++++++w+fFs+ ++++a+g r++r+t+ gyWkat Phvul.011G095500.1 9 PPGFRFFPTEEELVGFYLHNKLEGLRnaAAIDRVIPVVDINALEPWNLPTlageLCRGDTEQWFFFSPGQEREARGGRPSRTTACGYWKAT 99 8***********************9965556678***************545654445777****************************** PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 g+ v+s++++++g+kk++vfykg+ap g+kt+W m+ey+ Phvul.011G095500.1 100 GSPGYVYSSDNRVIGVKKSMVFYKGKAPMGRKTKWKMNEYK 140 ****************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-44 | 5 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.155 | 8 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.8E-23 | 9 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MTNIMEDHPP GFRFFPTEEE LVGFYLHNKL EGLRNAAAID RVIPVVDINA LEPWNLPTLA 60 GELCRGDTEQ WFFFSPGQER EARGGRPSRT TACGYWKATG SPGYVYSSDN RVIGVKKSMV 120 FYKGKAPMGR KTKWKMNEYK AISVPHQSNS VIPELRCEFS LYRVYIVSGT FRAFDRRPSE 180 SEGTESRVHQ SSSQISQLPE GGDSSSTNWN QVQLQEPLWD LEWEHFNWV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-30 | 9 | 165 | 18 | 163 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-30 | 9 | 165 | 18 | 163 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-30 | 9 | 165 | 18 | 163 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-30 | 9 | 165 | 18 | 163 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swm_B | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swm_C | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swm_D | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swp_A | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swp_B | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swp_C | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
3swp_D | 7e-30 | 9 | 165 | 21 | 166 | NAC domain-containing protein 19 |
4dul_A | 5e-30 | 9 | 165 | 18 | 163 | NAC domain-containing protein 19 |
4dul_B | 5e-30 | 9 | 165 | 18 | 163 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.011G095500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 1e-106 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007132453.1 | 1e-172 | hypothetical protein PHAVU_011G095500g | ||||
Swissprot | Q9FMR3 | 6e-80 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | V7AFR8 | 1e-171 | V7AFR8_PHAVU; Uncharacterized protein | ||||
STRING | XP_007132453.1 | 1e-172 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF871 | 34 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 3e-82 | NAC domain containing protein 90 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.011G095500.1 |
Entrez Gene | 18615672 |
Publications ? help Back to Top | |||
---|---|---|---|
|