![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G241200.1 | ||||||||
Common Name | PHAVU_007G241200g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 122aa MW: 14321.5 Da PI: 10.7967 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.2 | 4.4e-14 | 56 | 101 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+ ++++ k G+g+Wk I++ ++t+ q+ s+ qky Phvul.007G241200.1 56 KPWTEEEHRYFLCGLKNVGKGNWKEISKNYVRTKTPTQVASHAQKY 101 58*****************************9*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.674 | 50 | 106 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.73E-17 | 52 | 106 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.7E-10 | 54 | 100 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-10 | 54 | 104 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.7E-16 | 54 | 104 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 4.9E-12 | 56 | 101 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.67E-9 | 57 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MTFNRNSEDC LRLFGVNIVA KKPVTAADAE KDLNGAKSYI FLQRRHAFHD KKNKGKPWTE 60 EEHRYFLCGL KNVGKGNWKE ISKNYVRTKT PTQVASHAQK YFLRMSAFET RKRRRSLFDI 120 PL |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 110 | 114 | RKRRR |
2 | 110 | 115 | RKRRRS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G241200.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 1e-89 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007145462.1 | 2e-88 | hypothetical protein PHAVU_007G241200g, partial | ||||
Swissprot | Q9FKF9 | 2e-28 | M5162_ARATH; Probable transcription factor At5g61620 | ||||
TrEMBL | V7BLI5 | 5e-87 | V7BLI5_PHAVU; Uncharacterized protein (Fragment) | ||||
STRING | XP_007145462.1 | 8e-88 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF16861 | 7 | 8 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 9e-31 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G241200.1 |
Entrez Gene | 18626889 |
Publications ? help Back to Top | |||
---|---|---|---|
|