PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G034400.1
Common NamePHAVU_006G034400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 89aa    MW: 10151.7 Da    PI: 10.2749
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G034400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF101.14.2e-322878151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey++
  Phvul.006G034400.1 28 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN 78
                        79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-422079IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.8242080IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.14E-302083IPR002100Transcription factor, MADS-box
CDDcd002651.57E-402179No hitNo description
PROSITE patternPS0035002276IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-342242IPR002100Transcription factor, MADS-box
PfamPF003191.2E-272976IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-344257IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-345778IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MLQTMELPNQ AQEGSSQKKM GRGKIEIKRI ENTTNRQVTF CKRRNGLLKK AYELSVLCDA  60
EVALVVFSSR GRLYEYANNR LYQHTNPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-222081162Myocyte-specific enhancer factor 2B
1tqe_Q5e-222081162Myocyte-specific enhancer factor 2B
1tqe_R5e-222081162Myocyte-specific enhancer factor 2B
1tqe_S5e-222081162Myocyte-specific enhancer factor 2B
6c9l_A5e-222081162Myocyte-specific enhancer factor 2B
6c9l_B5e-222081162Myocyte-specific enhancer factor 2B
6c9l_C5e-222081162Myocyte-specific enhancer factor 2B
6c9l_D5e-222081162Myocyte-specific enhancer factor 2B
6c9l_E5e-222081162Myocyte-specific enhancer factor 2B
6c9l_F5e-222081162Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}.
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.006G034400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-133AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146364.13e-60hypothetical protein PHAVU_006G034400g
SwissprotP293811e-38AGL1_ARATH; Agamous-like MADS-box protein AGL1
SwissprotQ408851e-38AG_PETHY; Floral homeotic protein AGAMOUS
SwissprotQ435851e-38AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLV7BMU36e-59V7BMU3_PHAVU; Uncharacterized protein
STRINGXP_007146364.11e-59(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.26e-42MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  2. Matalon O, et al.
    Dephosphorylation of the adaptor LAT and phospholipase C-γ by SHP-1 inhibits natural killer cell cytotoxicity.
    Sci Signal, 2016. 9(429): p. ra54
    [PMID:27221712]
  3. Ehlers K, et al.
    The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana.
    PLoS ONE, 2016. 11(10): p. e0165075
    [PMID:27776173]
  4. Cheung AY,Zhan XY,Wang H,Wu HM
    Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein.
    Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8
    [PMID:8632979]