![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.006G034400.1 | ||||||||
Common Name | PHAVU_006G034400g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 89aa MW: 10151.7 Da PI: 10.2749 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 101.1 | 4.2e-32 | 28 | 78 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey++ Phvul.006G034400.1 28 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN 78 79***********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.6E-42 | 20 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.824 | 20 | 80 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.14E-30 | 20 | 83 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.57E-40 | 21 | 79 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 22 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.0E-34 | 22 | 42 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-27 | 29 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.0E-34 | 42 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.0E-34 | 57 | 78 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MLQTMELPNQ AQEGSSQKKM GRGKIEIKRI ENTTNRQVTF CKRRNGLLKK AYELSVLCDA 60 EVALVVFSSR GRLYEYANNR LYQHTNPS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-22 | 20 | 81 | 1 | 62 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.006G034400.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-133 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007146364.1 | 3e-60 | hypothetical protein PHAVU_006G034400g | ||||
Swissprot | P29381 | 1e-38 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
Swissprot | Q40885 | 1e-38 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
Swissprot | Q43585 | 1e-38 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | V7BMU3 | 6e-59 | V7BMU3_PHAVU; Uncharacterized protein | ||||
STRING | XP_007146364.1 | 1e-59 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.2 | 6e-42 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.006G034400.1 |
Entrez Gene | 18627663 |
Publications ? help Back to Top | |||
---|---|---|---|
|