![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.003G233200.1 | ||||||||
Common Name | PHAVU_003G233200g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 172aa MW: 20015.6 Da PI: 10.1154 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 29.4 | 1.7e-09 | 65 | 124 | 4 | 63 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++ rr+++NRe+ArrsR RK+ +e+L++ + eN++L ++l+ + +l++e+ Phvul.003G233200.1 65 DRKLRRMISNRESARRSRMRKQRHLENLRNQLSKCRVENRELNNRLQFVLHHRNRLRTEN 124 7899***************************************99987777777776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 9.5E-11 | 62 | 126 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.944 | 64 | 127 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.9E-7 | 66 | 124 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.62E-10 | 66 | 116 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 3.7E-8 | 66 | 119 | No hit | No description |
CDD | cd14702 | 1.02E-16 | 67 | 116 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 69 | 84 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MLTTHPPSDP LLGNLFSAFP DDFTPWDDDS HHLLSPKPVT SSSCSDKPEP EPAEPDQPVV 60 SVVDDRKLRR MISNRESARR SRMRKQRHLE NLRNQLSKCR VENRELNNRL QFVLHHRNRL 120 RTENEWLRSQ RTFLLQKVAN LTQTLIFQQF QQAISPAWTC NTSLIPINQV N* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 78 | 85 | RRSRMRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.003G233200.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007155805.1 | 1e-122 | hypothetical protein PHAVU_003G233200g | ||||
TrEMBL | V7CCE0 | 1e-121 | V7CCE0_PHAVU; Uncharacterized protein | ||||
STRING | XP_007155805.1 | 1e-122 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5435 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 3e-23 | basic leucine-zipper 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.003G233200.1 |
Entrez Gene | 18635813 |