![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.003G039400.1 | ||||||||
Common Name | PHAVU_003G039400g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 87aa MW: 9661.23 Da PI: 10.323 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.9 | 1.1e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Phvul.003G039400.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.179 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.23E-40 | 2 | 59 | No hit | No description |
SuperFamily | SSF55455 | 4.58E-31 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-34 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-34 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-34 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG 60 PRFSSSSEGV LFSGVLDFPS LVSWTT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-20 | 1 | 59 | 1 | 59 | MEF2C |
5f28_B | 2e-20 | 1 | 59 | 1 | 59 | MEF2C |
5f28_C | 2e-20 | 1 | 59 | 1 | 59 | MEF2C |
5f28_D | 2e-20 | 1 | 59 | 1 | 59 | MEF2C |
6byy_A | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_B | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_C | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_D | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_A | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_B | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_C | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_D | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269|PubMed:15530395, ECO:0000269|PubMed:25183521, ECO:0000269|PubMed:7632923}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.003G039400.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015043 | 1e-97 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007153483.1 | 7e-57 | hypothetical protein PHAVU_003G039400g | ||||
Swissprot | P29383 | 1e-36 | AGL3_ARATH; Agamous-like MADS-box protein AGL3 | ||||
TrEMBL | V7C5L0 | 2e-55 | V7C5L0_PHAVU; Uncharacterized protein | ||||
STRING | XP_007153483.1 | 3e-56 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.3 | 1e-39 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.003G039400.1 |
Entrez Gene | 18633820 |
Publications ? help Back to Top | |||
---|---|---|---|
|