![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.002G273100.1 | ||||||||
Common Name | PHAVU_002G273100g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 201aa MW: 22595.2 Da PI: 4.7098 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 105.4 | 7.4e-33 | 9 | 125 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGf F+Ptde+l+ ++L +k++ ++++ +i+++d+ ++Pw+L+ k+ ++ ++ yfFs+++ +nr+t++gyWk+ g +++ Phvul.002G273100.1 9 LPPGFSFSPTDEQLLLHFLYPKTSLPSHPT--IIPDLDLSLHDPWHLNGKALSSGNQHYFFSRAK--------ENRSTENGYWKEIGVTEA 89 79*********************9999888..8**************977777789999999874........5899************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v+s +e+vg+kk Lvf g+ap+g++t+Wvm+e+++ Phvul.002G273100.1 90 VVS-ASEKVGMKKYLVFNLGEAPQGTETSWVMQEFHI 125 ***.9999***************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.96E-39 | 3 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 38.015 | 9 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.1E-20 | 10 | 125 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MMASGTLNLP PGFSFSPTDE QLLLHFLYPK TSLPSHPTII PDLDLSLHDP WHLNGKALSS 60 GNQHYFFSRA KENRSTENGY WKEIGVTEAV VSASEKVGMK KYLVFNLGEA PQGTETSWVM 120 QEFHICSSSF TTASTRGRRK SDQCRSKWVL CKAYEKKSSE SEEGVNCYND ENDSGTELSW 180 LDEFYMSLDD DLEEVMSLPN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-32 | 7 | 162 | 18 | 174 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.002G273100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-101 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007159851.1 | 1e-149 | hypothetical protein PHAVU_002G273100g | ||||
Swissprot | Q8GWK6 | 1e-51 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | V7CRF2 | 1e-148 | V7CRF2_PHAVU; Uncharacterized protein | ||||
STRING | XP_007159851.1 | 1e-149 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 9e-53 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.002G273100.1 |
Entrez Gene | 18639280 |
Publications ? help Back to Top | |||
---|---|---|---|
|