PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus

Family

bZIP

Protein Properties

Length: 160aa MW: 17964.2 Da PI: 5.2904

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Phvul.002G237600.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	46.7	7.1e-15	30	88	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+q+NRe+ArrsR RK++ +e L +eL++eN ++ ++ + ++ + k+++e+ Phvul.002G237600.1 30 RKRKRMQSNRESARRSRMRKQQHLEGLSGQLDELKKENNEMNRNIGMTTQVYLKVEAEN 88 6789*****************************************99999998888776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.0E-16	26	90	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.3E-11	28	76	No hit	No description
PROSITE profile	PS50217	10.53	28	74	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.9E-10	30	76	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	4.25E-12	30	83	No hit	No description
CDD	cd14702	7.65E-17	31	79	No hit	No description
PROSITE pattern	PS00036	0	33	48	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MASPGGACSS GSSSLQNSGS EGDRGMVDQR KRKRMQSNRE SARRSRMRKQ QHLEGLSGQL 60 DELKKENNEM NRNIGMTTQV YLKVEAENAI LRAQMAELSN RLNSLNEIIS FINSTNYLVW 120 DEAQETQMFN DCGFMDAWNG MPLNQPIMAS ADNDILMMY*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	42	49	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Phvul.002G237600.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015034	0.0	AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007159436.1	1e-115	hypothetical protein PHAVU_002G237600g
Swissprot	C0Z2L5	2e-41	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	V7CQA0	1e-113	V7CQA0_PHAVU; Uncharacterized protein
STRING	XP_007159436.1	1e-114	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF613	34	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75390.1	2e-38	basic leucine-zipper 44

Link Out ? help Back to Top
Phytozome	Phvul.002G237600.1
Entrez Gene	18638918

Publications ? help Back to Top
Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]