![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.002G114500.2 | ||||||||
Common Name | PHAVU_002G114500g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 126aa MW: 13982.8 Da PI: 9.1885 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 105.7 | 3.3e-33 | 47 | 117 | 2 | 72 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT----- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhner 72 Cq+++C + l+ ak+y+rrhkvCe hskapvvlvs ++qrfCqqCs+fhel efDe+krsCr+ La+ r Phvul.002G114500.2 47 CQADECGVKLNMAKRYNRRHKVCERHSKAPVVLVSSIRQRFCQQCSKFHELAEFDETKRSCRKTLARRKTR 117 ******************************************************************98777 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.2E-30 | 40 | 108 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 25.709 | 44 | 121 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.35E-31 | 46 | 117 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.6E-28 | 47 | 117 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MDNGDDKEES SEGEAENGAK MVQKITIMLV CGNGKGSRTG SSSSSFCQAD ECGVKLNMAK 60 RYNRRHKVCE RHSKAPVVLV SSIRQRFCQQ CSKFHELAEF DETKRSCRKT LARRKTRTDM 120 SLGGD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-25 | 39 | 112 | 3 | 76 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.002G114500.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015043 | 7e-79 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007157979.1 | 3e-88 | hypothetical protein PHAVU_002G114500g | ||||
Refseq | XP_007157980.1 | 3e-88 | hypothetical protein PHAVU_002G114500g | ||||
Swissprot | Q6Z461 | 1e-29 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
TrEMBL | V7CKU0 | 7e-87 | V7CKU0_PHAVU; Uncharacterized protein | ||||
STRING | XP_007157979.1 | 1e-87 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 4e-27 | squamosa promoter binding protein-like 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.002G114500.2 |
Entrez Gene | 18637655 |