![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf02661g00017.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 149aa MW: 16815.1 Da PI: 10.2957 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 50.6 | 4.2e-16 | 81 | 130 | 4 | 54 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 ++r rrk+kNRe+A rsR+RK+a++ eL +kv Le+eN++Lkke +el+k Peinf101Scf02661g00017.1 81 DRRLRRKIKNRESAARSRARKQAYQNELVNKVSRLEEENMKLKKE-KELEK 130 789****************************************87.44444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 6.4E-11 | 78 | 145 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 8.2E-14 | 78 | 135 | No hit | No description |
PROSITE profile | PS50217 | 10.944 | 80 | 125 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.0E-13 | 81 | 130 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.0E-11 | 82 | 127 | No hit | No description |
CDD | cd14707 | 7.51E-15 | 82 | 119 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 85 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MNTPKIEQAL GETTLEDYLA KAGLFVADAS LGHTMSLDNP TAMQNFVPPI GLSPSNSIDA 60 LSDTPVSGRK RDAGNIDKTL DRRLRRKIKN RESAARSRAR KQAYQNELVN KVSRLEEENM 120 KLKKEKELEK VLSELSPEPR YQLRRTSSF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019069565.1 | 4e-83 | LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9C5Q2 | 2e-32 | AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3 | ||||
TrEMBL | M1C2P8 | 2e-81 | M1C2P8_SOLTU; Uncharacterized protein | ||||
STRING | Solyc01g008980.2.1 | 4e-83 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12596 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G41070.3 | 2e-22 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|