![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf01376g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 71aa MW: 7895.4 Da PI: 10.36 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 78 | 1.6e-24 | 13 | 65 | 1 | 53 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeee 53 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l+ l++e+ Peinf101Scf01376g00007.1 13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQLLSKEK 65 7**********************************************999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.135 | 12 | 71 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.2E-23 | 13 | 65 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
MKESGRKQGV ASPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQL 60 LSKEKPIPKM I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-22 | 9 | 61 | 7 | 59 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-22 | 9 | 61 | 7 | 59 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975523 | 3e-70 | HG975523.1 Solanum lycopersicum chromosome ch11, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019260359.1 | 6e-37 | PREDICTED: LOB domain-containing protein 4-like | ||||
Swissprot | Q9SHE9 | 6e-35 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A314LC49 | 1e-35 | A0A314LC49_NICAT; Lob domain-containing protein 4 | ||||
STRING | Solyc11g045530.1.1 | 1e-35 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400022286 | 1e-35 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 2e-37 | LOB domain-containing protein 4 |