PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf01318g05011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 190aa MW: 21028.4 Da PI: 9.4432 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.8 | 7.5e-33 | 103 | 159 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+kl k+rkpylheSRh hAl+R+Rg+gGrF Peinf101Scf01318g05011.1 103 EEPVFVNAKQYHGILRRRQSRAKAESENKL-LKARKPYLHESRHLHALKRARGCGGRF 159 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-35 | 101 | 162 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.576 | 102 | 162 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.8E-27 | 104 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.8E-23 | 105 | 127 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 107 | 127 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.8E-23 | 136 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
SSENEQPQKQ SEAQSPSSST VAGLSFPGTL TPNTHYMMPS QLGNANAMAH TAYPYPDPYY 60 RSIFAPYEAQ PYPAQPYPAQ SMVHLQLMGI QQAGVPLPSD NVEEPVFVNA KQYHGILRRR 120 QSRAKAESEN KLLKARKPYL HESRHLHALK RARGCGGRFQ KKTGESGDNS QANLNTDSNK 180 IEITSSENVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-20 | 102 | 159 | 1 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 1e-41 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006363651.1 | 1e-112 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_006363652.1 | 1e-112 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Swissprot | Q84JP1 | 4e-58 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | M1AUU3 | 1e-110 | M1AUU3_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400030813 | 1e-111 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6650 | 23 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 3e-56 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|