PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia

Family

NAC

Protein Properties

Length: 255aa MW: 28999.8 Da PI: 9.3362

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peinf101Scf00889g02030.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	160	9.4e-50	17	142	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+++d++k++PwdLp e+e yfFs+++ kya+g+r+nrat+sgyWka Peinf101Scf00889g02030.1 17 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SIIPDIDVHKSDPWDLPGD---LEQERYFFSTKEVKYANGSRSNRATNSGYWKA 97 79**************************.89***********54...46799*********************** PP NAM 86 tgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 tg dk+++s+ +++ vg+kktLvfykg+ +g +tdW+mheyrl Peinf101Scf00889g02030.1 98 TGLDKQIVSSrgQQQIVGMKKTLVFYKGKPLHGCRTDWIMHEYRL 142 *****9656666*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	8.24E-59	12	169	IPR003441	NAC domain
PROSITE profile	PS51005	56.812	17	169	IPR003441	NAC domain
Pfam	PF02365	4.4E-27	18	142	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0010089	Biological Process	xylem development
GO:0010150	Biological Process	leaf senescence
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 255 aa Download sequence Send to blast
MGIEKKISFV KNGVLRLPPG FRFHPTDEEL VVQYLKRKVF SCPLPASIIP DIDVHKSDPW 60 DLPGDLEQER YFFSTKEVKY ANGSRSNRAT NSGYWKATGL DKQIVSSRGQ QQIVGMKKTL 120 VFYKGKPLHG CRTDWIMHEY RLANLESNPP QLNNIPVQEN WVLCRIFLKK RGSKNEDENM 180 TQVLNNTSSR AAAGNNKLVF YDFMARERRD LNSSSVSAGS SGITELSTNE SEDHEESSSC 240 NSFITSVRRK NMALE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	7e-50	1	170	4	166	NO APICAL MERISTEM PROTEIN
1ut4_B	7e-50	1	170	4	166	NO APICAL MERISTEM PROTEIN
1ut7_A	7e-50	1	170	4	166	NO APICAL MERISTEM PROTEIN
1ut7_B	7e-50	1	170	4	166	NO APICAL MERISTEM PROTEIN
3swm_A	7e-50	1	170	7	169	NAC domain-containing protein 19
3swm_B	7e-50	1	170	7	169	NAC domain-containing protein 19
3swm_C	7e-50	1	170	7	169	NAC domain-containing protein 19
3swm_D	7e-50	1	170	7	169	NAC domain-containing protein 19
3swp_A	7e-50	1	170	7	169	NAC domain-containing protein 19
3swp_B	7e-50	1	170	7	169	NAC domain-containing protein 19
3swp_C	7e-50	1	170	7	169	NAC domain-containing protein 19
3swp_D	7e-50	1	170	7	169	NAC domain-containing protein 19
4dul_A	7e-50	1	170	4	166	NAC domain-containing protein 19
4dul_B	7e-50	1	170	4	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00507	DAP	Transfer from AT5G13180	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF510218	1e-173	AF510218.1 Petunia x hybrida nam-like protein 22 (NH22) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009600037.1	1e-139	PREDICTED: NAC domain-containing protein 83-like
Refseq	XP_018626075.1	1e-139	PREDICTED: NAC domain-containing protein 83-like
Swissprot	Q9FY93	3e-91	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A1S4CIT0	1e-137	A0A1S4CIT0_TOBAC; NAC domain-containing protein 83-like
TrEMBL	A0A1U7YR91	1e-137	A0A1U7YR91_NICSY; NAC domain-containing protein 18-like
TrEMBL	A0A314KYP5	1e-137	A0A314KYP5_NICAT; Nac domain-containing protein 83
STRING	XP_009600037.1	1e-138	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1387	23	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	2e-93	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]