PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00713g11009.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 145aa MW: 16078.5 Da PI: 8.7188 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 139.9 | 8.5e-44 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ +reda++sl+yeAe r+rdPvyG+vg+i+ lq+ Peinf101Scf00713g11009.1 7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEYRLRDPVYGCVGLISLLQH 91 7************************************************************************************ PP DUF260 86 qleqlkaelallkee 100 +l+q++ +l +k+e Peinf101Scf00713g11009.1 92 KLKQVQDDLLNAKKE 106 ********9988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.681 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 9.6E-44 | 7 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNAAQR 60 EDAVNSLAYE AEYRLRDPVY GCVGLISLLQ HKLKQVQDDL LNAKKELATY VGPSAMLPIL 120 QPSGNLMGVY QHIKRHGKGD KDDVV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-50 | 3 | 110 | 7 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-50 | 3 | 110 | 7 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009792980.1 | 1e-84 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_016501970.1 | 1e-84 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_019264646.1 | 1e-84 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_019264647.1 | 1e-84 | PREDICTED: LOB domain-containing protein 36-like | ||||
Swissprot | Q9FKZ3 | 8e-74 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A1S4CLH7 | 3e-83 | A0A1S4CLH7_TOBAC; LOB domain-containing protein 36-like | ||||
TrEMBL | A0A1U7Y2I1 | 3e-83 | A0A1U7Y2I1_NICSY; LOB domain-containing protein 36-like | ||||
TrEMBL | A0A314L3T6 | 3e-83 | A0A314L3T6_NICAT; Lob domain-containing protein 36 | ||||
STRING | XP_009792980.1 | 6e-84 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 3e-76 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|