PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00540g02017.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 135aa MW: 15333.5 Da PI: 8.7271 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 61.6 | 2.1e-19 | 12 | 58 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk lrrkC++dC++ pyfp ++p++f +vh+++Ga+nv k+l+ Peinf101Scf00540g02017.1 12 RCAACKQLRRKCPSDCIFLPYFPPNNPQRFSYVHRIYGANNVGKMLQ 58 6********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 13.508 | 11 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.1E-18 | 12 | 58 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
KKDLQTKMTS TRCAACKQLR RKCPSDCIFL PYFPPNNPQR FSYVHRIYGA NNVGKMLQDP 60 VYGSVGIITV LHQEIDHLQC QLAKVQAQID LLKAQTPVQG ELRQQIDFSA NLLADQNGIY 120 TSSPSSFDPS THWFY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-21 | 6 | 93 | 5 | 113 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-21 | 6 | 93 | 5 | 113 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-46 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019238658.1 | 3e-70 | PREDICTED: LOB domain-containing protein 24-like | ||||
Swissprot | P59467 | 9e-31 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
Swissprot | P59468 | 8e-31 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A1J6KI98 | 6e-69 | A0A1J6KI98_NICAT; Lob domain-containing protein 24 | ||||
STRING | XP_009589427.1 | 4e-67 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5277 | 20 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 3e-33 | LOB domain-containing protein 24 |