PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00394g09009.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 152aa MW: 16960.5 Da PI: 7.2076 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 138.8 | 1.9e-43 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 +CaaCk+lrrkC+++C++apyfp e+p kf nvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+ Peinf101Scf00394g09009.1 11 PCAACKFLRRKCVPSCIFAPYFPPEEPIKFTNVHKVFGASNVSKLLNEIQPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQR 95 7************************************************************************************ PP DUF260 86 qleqlkaelallke 99 q+ +l++el+++++ Peinf101Scf00394g09009.1 96 QVIRLQKELDAINA 109 *********98876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.069 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.7E-43 | 11 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MASSSSYSNP PCAACKFLRR KCVPSCIFAP YFPPEEPIKF TNVHKVFGAS NVSKLLNEIQ 60 PHQREDAVNS LAYEAEARLK DPVYGCVGAI SVLQRQVIRL QKELDAINAD LMQYANYAES 120 RGAKNQMEIN ITMKLMELVA LEELSSITEG RC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-64 | 2 | 115 | 2 | 115 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-64 | 2 | 115 | 2 | 115 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015168799.1 | 1e-77 | PREDICTED: LOB domain-containing protein 25-like | ||||
Refseq | XP_018625400.1 | 1e-77 | PREDICTED: LOB domain-containing protein 25-like isoform X2 | ||||
Swissprot | Q9FML4 | 4e-67 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | M1A9H4 | 3e-76 | M1A9H4_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400017805 | 5e-77 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-69 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|