PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00250g01004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 169aa MW: 18305.3 Da PI: 6.091 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 129.9 | 1.1e-40 | 11 | 110 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 +C aCk+l+rkC+++C++apyfp e+p kfanvh++FGasnv kll++l++++re a++sl+yeAear+rdPvyG+vg+i lq+ Peinf101Scf00250g01004.1 11 PCGACKFLGRKCVPGCIFAPYFPPEDPIKFANVHRVFGASNVGKLLSDLQPHQREVAANSLAYEAEARMRDPVYGCVGTIAVLQR 95 7************************************************************************************ PP DUF260 86 qleqlkaelallkee 100 ql + + el+++++e Peinf101Scf00250g01004.1 96 QLINFQRELDATNAE 110 *********999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.323 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.0E-40 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MASSSSFPNS PCGACKFLGR KCVPGCIFAP YFPPEDPIKF ANVHRVFGAS NVGKLLSDLQ 60 PHQREVAANS LAYEAEARMR DPVYGCVGTI AVLQRQLINF QRELDATNAE LMKYANREVG 120 SSGGVVINNN QMGNQQRSFN SSGGIASDQT SHQLNDDVSG NHNPEVNDE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 8e-57 | 10 | 120 | 10 | 120 | LOB family transfactor Ramosa2.1 |
5ly0_B | 8e-57 | 10 | 120 | 10 | 120 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009597524.1 | 3e-74 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
Refseq | XP_016505823.1 | 3e-74 | PREDICTED: LOB domain-containing protein 25-like | ||||
Refseq | XP_018625398.1 | 3e-74 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
Refseq | XP_018625399.1 | 3e-74 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
Swissprot | Q9FML4 | 1e-58 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A1S4CXF4 | 7e-73 | A0A1S4CXF4_TOBAC; LOB domain-containing protein 25-like | ||||
STRING | XP_009597524.1 | 1e-73 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 6e-61 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|