PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00056g00033.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 165aa MW: 19256.1 Da PI: 8.6136 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.7 | 8.7e-11 | 83 | 119 | 3 | 39 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 +WT+eE+ l++ + +++G+g+W++I+r + +Rt+ q Peinf101Scf00056g00033.1 83 PWTEEEHRLFLIGLEKYGKGDWRSISRNVVVTRTPTQ 119 7*****************************99*9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.55 | 76 | 129 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.87E-10 | 78 | 132 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.6E-9 | 79 | 119 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 4.5E-5 | 80 | 130 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-10 | 81 | 120 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.1E-9 | 83 | 119 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.98E-8 | 83 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MKSLAKWLQN RMFYTLNKLP SINRRSCSGK TQQEIISHYD DLVHDVLEID LGRVEPPSYL 60 DVLCDNEISF KKYCEIERKK GIPWTEEEHR LFLIGLEKYG KGDWRSISRN VVVTRTPTQA 120 MKKERKRFSI HDITTAVDTN PVPPQSSFQN KEALKISTLP CKDEE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975517 | 1e-34 | HG975517.1 Solanum lycopersicum chromosome ch05, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009795456.1 | 3e-62 | PREDICTED: transcription factor DIVARICATA-like | ||||
Refseq | XP_016473251.1 | 3e-62 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q9FNN6 | 4e-29 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A1S4A9J2 | 7e-61 | A0A1S4A9J2_TOBAC; transcription factor DIVARICATA-like | ||||
TrEMBL | A0A1U7Y0L8 | 7e-61 | A0A1U7Y0L8_NICSY; transcription factor DIVARICATA-like | ||||
STRING | XP_009795456.1 | 1e-61 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-41 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|