![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00192g01413.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 71aa MW: 8316.72 Da PI: 10.349 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 40.6 | 4.6e-13 | 5 | 65 | 17 | 80 |
E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 +lpkkfa e+g+ ++++ l+++d + r W++++ ++ +++ ++ W +F+ an+L++gD + Peaxi162Scf00192g01413.1 5 WLPKKFAMENGLT-NKKFGLIIRDGRQRYWNFRI--YTSGAKVYVGGKWGKFCVANDLQVGDHI 65 59********887.56789***************..88888999******************75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 10.884 | 1 | 71 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 3.53E-12 | 5 | 69 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.0E-10 | 5 | 65 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 9.80E-10 | 6 | 65 | No hit | No description |
Gene3D | G3DSA:2.40.330.10 | 2.2E-10 | 6 | 69 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
MKFEWLPKKF AMENGLTNKK FGLIIRDGRQ RYWNFRIYTS GAKVYVGGKW GKFCVANDLQ 60 VGDHIRCEVV T |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009767536.1 | 2e-24 | PREDICTED: B3 domain-containing protein REM10-like | ||||
Refseq | XP_016504093.1 | 2e-24 | PREDICTED: B3 domain-containing protein REM10-like | ||||
Refseq | XP_019254323.1 | 2e-24 | PREDICTED: putative B3 domain-containing protein REM4 isoform X1 | ||||
Refseq | XP_019254325.1 | 2e-24 | PREDICTED: putative B3 domain-containing protein REM4 isoform X1 | ||||
TrEMBL | A0A1S4CSL3 | 5e-23 | A0A1S4CSL3_TOBAC; B3 domain-containing protein REM10-like | ||||
TrEMBL | A0A1U7VRG4 | 5e-23 | A0A1U7VRG4_NICSY; B3 domain-containing protein REM10-like | ||||
STRING | XP_009767536.1 | 9e-24 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA322 | 15 | 171 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24645.1 | 2e-07 | B3 family protein |