PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00098g00710.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 70aa MW: 8004.23 Da PI: 7.2538 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 31.5 | 3.2e-10 | 32 | 69 | 59 | 96 |
EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS B3 59 yvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 + l+kGW+++v++n L +gD++ Fkl++++ f l +++ Peaxi162Scf00098g00710.1 32 IQLKKGWSKYVEDNALYVGDVCAFKLIDDKLFILEISI 69 5689***********************98888666655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 9.023 | 1 | 70 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 8.6E-9 | 29 | 67 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 1.61E-8 | 32 | 66 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.1E-7 | 32 | 68 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
MENGCKKQDV NASKNEIKLH PSDEKISQTF GIQLKKGWSK YVEDNALYVG DVCAFKLIDD 60 KLFILEISIR |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |