![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr041076.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 185aa MW: 21278.6 Da PI: 8.9495 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 165.4 | 2e-51 | 25 | 151 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 pGfrFhPtdeelv++yL++k+++k+++l e ik++diyk++PwdLpk+ a++kewyfF+kr +ky+++ r+nr+t sg+Wkatg dk+++s++ge Pbr041076.1 25 LPGFRFHPTDEELVDFYLRRKIQKKPISL-ELIKSIDIYKHDPWDLPKT--AGDKEWYFFCKRGRKYKNSIRPNRVTGSGFWKATGIDKPIHSHGGES 119 59***************************.99***************44..589***************************************95544 PP NAM 100 ...vglkktLvfykgrapkgektdWvmheyrl 128 glkktLv+y+g+a kg+ktdW+mhe+rl Pbr041076.1 120 hacSGLKKTLVYYRGSAGKGSKTDWMMHEFRL 151 4559**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.15E-53 | 24 | 159 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 48.944 | 24 | 184 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-26 | 26 | 151 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MDNTYYSPSN KDDHQYTDDE DDVQLPGFRF HPTDEELVDF YLRRKIQKKP ISLELIKSID 60 IYKHDPWDLP KTAGDKEWYF FCKRGRKYKN SIRPNRVTGS GFWKATGIDK PIHSHGGESH 120 ACSGLKKTLV YYRGSAGKGS KTDWMMHEFR LPNSSSSNEH NNRSSNPKNM NTDPQQEAVS 180 EKSA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-46 | 15 | 158 | 7 | 149 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-46 | 15 | 158 | 7 | 149 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-46 | 15 | 158 | 7 | 149 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-46 | 15 | 158 | 7 | 149 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swm_B | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swm_C | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swm_D | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swp_A | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swp_B | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swp_C | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
3swp_D | 2e-46 | 15 | 158 | 10 | 152 | NAC domain-containing protein 19 |
4dul_A | 2e-46 | 15 | 158 | 7 | 149 | NAC domain-containing protein 19 |
4dul_B | 2e-46 | 15 | 158 | 7 | 149 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr041076.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009361809.1 | 1e-132 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9SK55 | 4e-71 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A498IWU5 | 1e-120 | A0A498IWU5_MALDO; Uncharacterized protein | ||||
STRING | XP_009361809.1 | 1e-131 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1013 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 4e-72 | NAC domain containing protein 42 |