![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr035288.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 99aa MW: 11321 Da PI: 9.9104 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 163.5 | 1.3e-50 | 2 | 77 | 1 | 76 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gnyklpk++DnneVlkALc eAGw+ve DGttyrkg++ Pbr035288.1 2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDEAGWTVELDGTTYRKGCSGS 77 5899********************************************************************9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 2.1E-47 | 3 | 76 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRLYGNY KLPKHCDNNE VLKALCDEAG 60 WTVELDGTTY RKGCSGSCLP GKCPESRQTD KWEALWLT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 1e-23 | 6 | 82 | 372 | 446 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 1e-23 | 6 | 82 | 372 | 446 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 1e-23 | 6 | 82 | 372 | 446 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 1e-23 | 6 | 82 | 372 | 446 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr035288.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009359371.1 | 5e-48 | PREDICTED: BES1/BZR1 homolog protein 4-like | ||||
Swissprot | Q6EUF1 | 8e-29 | BZR4_ORYSJ; Protein BZR1 homolog 4 | ||||
TrEMBL | A0A4D8Z6E1 | 2e-39 | A0A4D8Z6E1_SALSN; Uncharacterized protein | ||||
STRING | XP_009359371.1 | 2e-47 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15152 | 11 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G78700.1 | 1e-29 | BES1/BZR1 homolog 4 |