![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr034559.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 77aa MW: 8331.03 Da PI: 10.608 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 127.7 | 3.4e-40 | 12 | 76 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 +akGlnPG+ivl+vv gll++flvgny+lyvyaq++lPP+kkkPvskkklk+e+lkqGv++PGe Pbr034559.1 12 SDAKGLNPGIIVLIVVVGLLVIFLVGNYALYVYAQRTLPPKKKKPVSKKKLKKERLKQGVSAPGE 76 589*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 1.0E-38 | 13 | 76 | IPR006779 | DNA binding protein S1FA |
ProDom | PD019013 | 0.004 | 15 | 76 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 77 aa Download sequence Send to blast |
MADQFEDKVP PSDAKGLNPG IIVLIVVVGL LVIFLVGNYA LYVYAQRTLP PKKKKPVSKK 60 KLKKERLKQG VSAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr034559.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009358155.1 | 1e-46 | PREDICTED: DNA-binding protein S1FA | ||||
Swissprot | Q7XLX6 | 7e-19 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | W9SCA3 | 7e-25 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
STRING | XP_009358155.1 | 5e-46 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Publications ? help Back to Top | |||
---|---|---|---|
|