![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr027119.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 204aa MW: 23088.3 Da PI: 9.5495 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 154.7 | 4e-48 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+e++++ ++PwdLp e+e yfFs+r++ky++g+r+nr+t+sgyWkatg dk+++s+ k+ Pbr027119.1 14 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEINVCLYDPWDLPGD---LEQERYFFSNRESKYRNGNRANRVTSSGYWKATGVDKKIVSSrKN 107 79****************************.89***************54...46799***********************************98567 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + vg kktLvfykg++p+ +ktdWvmhey l Pbr027119.1 108 NIVGKKKTLVFYKGKSPNVSKTDWVMHEYCL 138 77***************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.28E-56 | 10 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.895 | 14 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-25 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MDKFNFPRNG MTRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEIN VCLYDPWDLP 60 GDLEQERYFF SNRESKYRNG NRANRVTSSG YWKATGVDKK IVSSRKNNIV GKKKTLVFYK 120 GKSPNVSKTD WVMHEYCLVN AETAASIHTT ENALTPKGNW VLCRVFLKKR SGKTDEEIMV 180 NYNGIRVCDN ASPVSSSSSC SSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-44 | 14 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-44 | 14 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-44 | 14 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-44 | 14 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
4dul_A | 2e-44 | 14 | 173 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-44 | 14 | 173 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr027119.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018498698.1 | 1e-151 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 3e-78 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A498I8K5 | 1e-140 | A0A498I8K5_MALDO; Uncharacterized protein | ||||
STRING | XP_008392723.1 | 1e-137 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 3e-80 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|