![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr026163.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 165aa MW: 18621.3 Da PI: 10.8224 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 96.5 | 2.9e-30 | 33 | 89 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq Rakle+++kl +k kpylheS h hAl+R+RgsgGrF Pbr026163.1 33 NEPIYVNAKQYRAILRRRQFRAKLEAQNKL-IKVHKPYLHESQHVHALKRARGSGGRF 89 59****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.4E-34 | 31 | 92 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 34.304 | 32 | 92 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.4E-25 | 34 | 89 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 6.4E-22 | 35 | 57 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 37 | 57 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 6.4E-22 | 66 | 89 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MRYLPCKCLQ IHHPQVLGIT PGRVPLPLDL TENEPIYVNA KQYRAILRRR QFRAKLEAQN 60 KLIKVHKPYL HESQHVHALK RARGSGGRFL NKKKVKDSKP NTLNHRVNAS DVAVGNTVHE 120 PNNYRDGASI TSCSEVTRTS NSGDKFPRQD FRFSGYPSHI GGTM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-19 | 33 | 98 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr026163.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008228232.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X3 | ||||
Refseq | XP_016649370.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_016649371.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_016649372.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_016649373.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_016649374.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_016649375.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_016649377.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-3 isoform X3 | ||||
Swissprot | Q93ZH2 | 8e-48 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
TrEMBL | A0A314XI63 | 6e-86 | A0A314XI63_PRUYE; Nuclear transcription factor Y subunit A-3 isoform X1 | ||||
TrEMBL | A0A314XXE2 | 2e-85 | A0A314XXE2_PRUYE; Nuclear transcription factor Y subunit A-3 isoform X1 | ||||
STRING | XP_009372379.1 | 4e-85 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10120 | 25 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72830.1 | 3e-50 | nuclear factor Y, subunit A3 |