PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

M-type_MADS

Protein Properties

Length: 63aa MW: 7173.44 Da PI: 10.8429

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr022183.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	104	5.2e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s Pbr022183.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.165	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.98E-31	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.69E-38	2	60	No hit	No description
PRINTS	PR00404	6.5E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.5E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIVFSN RGKLYEFCSS 60 PR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-20	1	60	1	60	MEF2C
5f28_B	3e-20	1	60	1	60	MEF2C
5f28_C	3e-20	1	60	1	60	MEF2C
5f28_D	3e-20	1	60	1	60	MEF2C
6byy_A	2e-20	1	60	1	60	MEF2 CHIMERA
6byy_B	2e-20	1	60	1	60	MEF2 CHIMERA
6byy_C	2e-20	1	60	1	60	MEF2 CHIMERA
6byy_D	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_A	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_B	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_C	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_D	2e-20	1	60	1	60	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr022183.1

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC415236	2e-96	KC415236.1 Malus domestica cultivar Fuji Beni Shogun MADS9-2 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007153483.1	6e-37	hypothetical protein PHAVU_003G039400g
Refseq	XP_012487593.1	2e-36	PREDICTED: MADS-box protein CMB1-like
Swissprot	Q03489	5e-36	AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
Swissprot	Q8LLR0	4e-36	MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBL	A0A2H5MYT2	3e-37	A0A2H5MYT2_CITUN; Uncharacterized protein
STRING	Lus10017870	2e-37	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	1e-39	MIKC_MADS family protein

Publications ? help Back to Top
Immink RG,Gadella TW,Ferrario S,Busscher M,Angenent GC Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(4): p. 2416-21 [PMID:11854533] Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ Differential expression of two MADS box genes in wild-type and mutant petunia flowers. Plant Cell, 1992. 4(8): p. 983-93 [PMID:1356537] Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot., 2006. 57(1): p. 33-42 [PMID:16291798] Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751]