PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr016997.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 63aa MW: 6881.75 Da PI: 4.7224 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 35.8 | 1.1e-11 | 1 | 36 | 339 | 374 |
GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 +ll ++ +gyrvee++g+l+lgW++rpL+++S W+ Pbr016997.1 1 MLLTLFSAEGYRVEENQGCLTLGWHNRPLIAASGWQ 36 6999*******************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 3.7E-9 | 1 | 36 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MLLTLFSAEG YRVEENQGCL TLGWHNRPLI AASGWQVMSM PEATTNQEAV GIINQNNNPN 60 HI* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr016997.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ007887 | 3e-70 | DQ007887.1 Malus x domestica DELLA protein (L3a) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001315645.1 | 4e-30 | DELLA protein GAI-like | ||||
TrEMBL | A0A498HSU0 | 4e-30 | A0A498HSU0_MALDO; Uncharacterized protein | ||||
STRING | XP_008337344.1 | 3e-30 | (Malus domestica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14920.1 | 1e-13 | GRAS family protein |