![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr015835.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 186aa MW: 21332 Da PI: 9.3085 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 44.1 | 6.4e-14 | 4 | 56 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk 49 lppG+rF Pt+eel+++yL++k++g++ l+++i+ + iy+++Pw+Lp+ Pbr015835.1 4 LPPGYRFYPTEEELISFYLQNKLDGRSeelnRVLDRIIPVIYIYEFNPWKLPR 56 79************************966532233469999**********94 PP | |||||||
2 | NAM | 31.7 | 4.5e-10 | 68 | 99 | 96 | 127 |
NAM 96 kgelvglkktLvfykgrapkgektdWvmheyr 127 ++ +g k+t+ fy g+ap+g+kt+W+m+ey+ Pbr015835.1 68 YNRPIGHKRTMGFYIGSAPRGKKTEWMMNEYK 99 45679**************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 16.05 | 1 | 142 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 9.15E-26 | 3 | 107 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-13 | 5 | 99 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MEDLPPGYRF YPTEEELISF YLQNKLDGRS EELNRVLDRI IPVIYIYEFN PWKLPRSPST 60 VYSSNSNYNR PIGHKRTMGF YIGSAPRGKK TEWMMNEYKA IEEHADHDNQ LSMAASSSIA 120 RTSTPSAPTL RQEFSLCPVH RKSKSLRAFD RLHPGIEITR NPSFNIASNS CSRCKSSRST 180 FDNDK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-15 | 4 | 102 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-15 | 4 | 102 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-15 | 4 | 102 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-15 | 4 | 102 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swm_B | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swm_C | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swm_D | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swp_A | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swp_B | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swp_C | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
3swp_D | 5e-15 | 4 | 102 | 20 | 147 | NAC domain-containing protein 19 |
4dul_A | 4e-15 | 4 | 102 | 17 | 144 | NAC domain-containing protein 19 |
4dul_B | 4e-15 | 4 | 102 | 17 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr015835.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009366767.1 | 1e-82 | PREDICTED: NAC domain-containing protein 90-like | ||||
TrEMBL | A0A498HY67 | 2e-81 | A0A498HY67_MALDO; Uncharacterized protein | ||||
STRING | XP_009366767.1 | 5e-82 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF871 | 34 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 5e-32 | NAC domain containing protein 90 |