![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr009693.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 170aa MW: 18991.2 Da PI: 6.7147 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 28.2 | 4.2e-09 | 92 | 134 | 8 | 50 |
HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 rr NReA r++R +Kka ++ Lee++ +L+ N++L +++ Pbr009693.1 92 RRPLGNREAVRKYRDKKKAHTAYLEEEIRKLQVLNQQLVGKIQ 134 66788*********************************88876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.9E-9 | 83 | 152 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.2E-10 | 90 | 150 | No hit | No description |
SuperFamily | SSF57959 | 2.75E-8 | 90 | 136 | No hit | No description |
CDD | cd14686 | 3.36E-9 | 90 | 135 | No hit | No description |
Pfam | PF07716 | 4.6E-14 | 91 | 139 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MDDGEVVASD HALLPNPNCS SNFPGSTSVD TFFDEILNTQ TCTHTHTCNP PGPDAAHTHT 60 CYHTHTQVLS SEDDDDDDSK NKERSIPKPQ RRRPLGNREA VRKYRDKKKA HTAYLEEEIR 120 KLQVLNQQLV GKIQAQATLE AEFLRLKGLV LGLRGKIDNE LGGFPFQKQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr009693.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008364717.2 | 2e-88 | basic leucine zipper 23-like | ||||
Swissprot | Q8VY76 | 1e-55 | BZP19_ARATH; Basic leucine zipper 19 | ||||
TrEMBL | A0A498JKY4 | 9e-87 | A0A498JKY4_MALDO; Uncharacterized protein | ||||
STRING | XP_008364717.1 | 2e-85 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2567 | 32 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35040.1 | 2e-29 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|