PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

MIKC_MADS

Protein Properties

Length: 203aa MW: 23167 Da PI: 8.6454

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr004234.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	79.7	2e-25	9	57	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifss+gkl+e Pbr004234.1 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSSQGKLFEL 57 79********************************************996 PP
2	K-box	53.6	9.7e-19	81	174	6	99
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++++ e+++ ++e++ +k+eie Lq+ +R + + ++++l eLq Le++Le+ + ++Rs K+++l+++i+ l++ e l +nk+L+ k+e Pbr004234.1 81 TEQTMETQTLDAKKEINLMKQEIEILQKGLRYMFDGGAGTMTLDELQVLEKHLETWIYHVRSAKMDILFQEIQLLRNSEGILAAANKYLQDKIE 174 4556778888999******************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF55455	4.58E-28	1	77	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.59	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.1E-36	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.49E-40	2	72	No hit	No description
PRINTS	PR00404	5.1E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-22	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.1E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.1E-27	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	4.2E-18	88	173	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	10.884	89	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048364	Biological Process	root development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 203 aa Download sequence Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSS QGKLFELATK 60 GSMQGLIERY MKMKPTRAPQ TEQTMETQTL DAKKEINLMK QEIEILQKGL RYMFDGGAGT 120 MTLDELQVLE KHLETWIYHV RSAKMDILFQ EIQLLRNSEG ILAAANKYLQ DKIEVNTGAN 180 DFMPIATDNT YPLTIPNDIY EF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-16	1	59	1	59	MEF2C
5f28_B	6e-16	1	59	1	59	MEF2C
5f28_C	6e-16	1	59	1	59	MEF2C
5f28_D	6e-16	1	59	1	59	MEF2C
6byy_A	7e-16	1	59	1	59	MEF2 CHIMERA
6byy_B	7e-16	1	59	1	59	MEF2 CHIMERA
6byy_C	7e-16	1	59	1	59	MEF2 CHIMERA
6byy_D	7e-16	1	59	1	59	MEF2 CHIMERA
6bz1_A	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_B	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_C	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_D	8e-16	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr004234.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP164021	0.0	KP164021.1 Pyrus pyrifolia clone PpAGL12-2 AGL12-like MADS-box protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009379081.1	1e-150	PREDICTED: agamous-like MADS-box protein AGL12
Swissprot	Q38841	7e-81	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A0D4ZY50	1e-139	A0A0D4ZY50_PYRPY; AGL12-like MADS-box protein
STRING	XP_009379081.1	1e-150	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7566	31	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	3e-83	AGAMOUS-like 12

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]