 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Pbr001920.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
| Family |
TALE |
| Protein Properties |
Length: 136aa MW: 15889.8 Da PI: 8.4555 |
| Description |
TALE family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Pbr001920.1 | genome | CPETR | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 27.4 | 5.6e-09 | 84 | 117 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yp+++++ LA+ ++L+++q+ +WF N+R ++
Pbr001920.1 84 WPYPTEADKISLAQVTRLDQKQINNWFINQRKRH 117
59*****************************985 PP
|
| 2 | ELK | 32.9 | 1.4e-11 | 37 | 57 | 1 | 21 |
ELK 1 ELKhqLlrKYsgyLgsLkqEF 21
ELK+ Llr Ysgy+++Lk EF
Pbr001920.1 37 ELKDKLLRRYSGYISTLKREF 57
9*******************9 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Sequence ? help Back to Top |
| Protein Sequence Length: 136 aa
Download sequence Send
to blast |
MLDLHANDDA AGSSDEGDWS GGEIEAQDSP RTNEDHELKD KLLRRYSGYI STLKREFTKK 60
KKNGKLPREA RKILFDWWNL HDKWPYPTEA DKISLAQVTR LDQKQINNWF INQRKRHWKP 120
SENMQYAVMD SLCGP*
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. |
| UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
| Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
Mol. Biol. Evol., 2006. 23(2): p. 469-78
[PMID:16280546] - Zhang XL,Yang ZP,Zhang J,Zhang LG
Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana.
Int J Mol Sci, 2013. 14(7): p. 14872-91
[PMID:23863694] - Kuijt SJ, et al.
Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
Plant Physiol., 2014. 164(4): p. 1952-66
[PMID:24532604] - Scofield S,Dewitte W,Murray JA
STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
Plant Signal Behav, 2018.
[PMID:24776954] - Lee JE,Lampugnani ER,Bacic A,Golz JF
SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
Plant J., 2014. 80(1): p. 122-35
[PMID:25060324] - Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
[PMID:26108442] - Khan M, et al.
Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
Plant Physiol., 2015. 169(3): p. 2166-86
[PMID:26417006] - Li Z, et al.
Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
J Integr Plant Biol, 2016. 58(12): p. 959-970
[PMID:27273574] - Lozano-Sotomayor P, et al.
Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
Plant J., 2016. 88(3): p. 437-451
[PMID:27402171]
|
