![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr000189.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 75aa MW: 8408.11 Da PI: 4.269 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.5 | 9.5e-11 | 26 | 67 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + ++++E+ l+++ ++ G + W++Ia +++ gRt++++ +w Pbr000189.1 26 LQFSEDEEALIIRMYNLVGER-WALIAGRIP-GRTAEEIEKYWS 67 579******************.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.17 | 20 | 74 | IPR017930 | Myb domain |
SMART | SM00717 | 1.8E-7 | 24 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.8E-9 | 27 | 69 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.5E-13 | 27 | 68 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.9E-10 | 27 | 66 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.58E-8 | 28 | 66 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MADSEHSSSD DTVVDSREKS TDKSELQFSE DEEALIIRMY NLVGERWALI AGRIPGRTAE 60 EIEKYWSSTH STSQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr000189.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009365064.1 | 2e-47 | PREDICTED: MYB-like transcription factor ETC1 | ||||
Swissprot | Q9LNI5 | 4e-17 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A498JU26 | 2e-44 | A0A498JU26_MALDO; Uncharacterized protein | ||||
STRING | XP_009365064.1 | 7e-47 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2692 | 31 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 2e-19 | MYB_related family protein |